PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05025A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 264aa    MW: 28712.5 Da    PI: 8.705
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05025AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-181461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEde+lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Oropetium_20150105_05025A 14 KGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                               79******************************99************97 PP

2Myb_DNA-binding568.9e-1867111147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg++T eEdel+++++  lG++ W++Ia  ++ gRt++++k++w+++
  Oropetium_20150105_05025A  67 RGNFTDEEDELIIRLHSVLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                                89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.207961IPR017930Myb domain
SMARTSM007174.7E-141363IPR001005SANT/Myb domain
SuperFamilySSF466896.11E-3013108IPR009057Homeodomain-like
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001679.97E-121661No hitNo description
PROSITE profilePS5129428.35462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2865117IPR009057Homeodomain-like
SMARTSM007171.0E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1567111IPR001005SANT/Myb domain
CDDcd001678.16E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDEEDELIIR LHSVLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLISRG  120
IDPQTHRPVG SVDSTAAVAA PRMTLLQPAN KLAAPRATLE SSSDDVGAGS TSTSNSSSGA  180
STRGAETPRC PDLNLDLFVG LPPPPPPPPA DTLTSHRPPV CLCYHLGLRA GEACGCHQVA  240
DSAATQRFST TTYFRPLEQG QYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF3725211e-151EF372521.1 Saccharum officinarum MYB protein mRNA, complete cds.
GenBankHF6794281e-151HF679428.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB22 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638107.11e-119PREDICTED: myb-related protein 308
SwissprotQ9SZP12e-94MYB4_ARATH; Transcription repressor MYB4
TrEMBLQ069441e-121Q06944_HORVU; MybHv5
STRINGMLOC_71041.11e-120(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-93myb domain protein 4